PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007732m
Common NameCARUB_v10007732mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 263aa    MW: 30108.3 Da    PI: 7.9724
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007732mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.2e-131259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l  ++  +G  +W+ ++ + g+ R +k+c++rw +yl
  Carubv10007732m 12 KGLWSPEEDEKLRSCILSHGHSCWTNVPIKAGLQRNGKSCRLRWINYL 59
                     678*******************************************97 PP

2Myb_DNA-binding445.2e-1469110548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++eE+e ++  +  lG++ W+ Ia+ ++ gRt++++k++w+++l
  Carubv10007732m  69 SAEEEETILTFHSSLGNK-WSQIAKFLP-GRTDNEIKNYWHSHL 110
                      89****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.29763IPR017930Myb domain
SuperFamilySSF466896.24E-2711106IPR009057Homeodomain-like
SMARTSM007176.7E-101161IPR001005SANT/Myb domain
PfamPF002495.2E-121259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-201366IPR009057Homeodomain-like
CDDcd001671.12E-71559No hitNo description
PROSITE profilePS5129416.81664114IPR017930Myb domain
SMARTSM007172.1E-1264112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2367113IPR009057Homeodomain-like
CDDcd001672.89E-969110No hitNo description
PfamPF002492.3E-1269110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MAKTKSGEKQ RKGLWSPEED EKLRSCILSH GHSCWTNVPI KAGLQRNGKS CRLRWINYLR  60
PGLKRDMISA EEEETILTFH SSLGNKWSQI AKFLPGRTDN EIKNYWHSHL KKRWLKSHNL  120
QHPKSISSSS SSLVSCQKRN PETLISNHVI SFQRLVENKS SSPSQESNGN NNSHQCSSAP  180
EFPRLFFNEW LSSSSDPQVD DSSVFTDSKH DQAPNVENSV LDYEETSDVD QFHYNETMIN  240
NNNWTLNDVV FGSKFQKHES QN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22121137107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196090.0AY519609.1 Arabidopsis thaliana MYB transcription factor (At4g25560) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286169.10.0hypothetical protein CARUB_v10007732mg
SwissprotQ9M0K41e-153LAF1_ARATH; Transcription factor LAF1
TrEMBLR0FAN00.0R0FAN0_9BRAS; Uncharacterized protein
STRINGAT4G25560.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-146myb domain protein 18